PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10041355
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NF-YB
Protein Properties Length: 175aa    MW: 19497.6 Da    PI: 5.3374
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10041355genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB167.12.2e-5242135497
        NF-YB   4 qdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                  qdr+lPianv+r+mk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wal++lGf+dy  plk yl +yrelege+
  Lus10041355  42 QDRMLPIANVGRMMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDVCWALSSLGFDDYCSPLKRYLLRYRELEGER 135
                  9******************************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.7E-5240165IPR009072Histone-fold
SuperFamilySSF471131.77E-3942160IPR009072Histone-fold
PfamPF008086.8E-2745109IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.8E-177391No hitNo description
PROSITE patternPS0068507692IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.8E-1792110No hitNo description
PRINTSPR006151.8E-17111129No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MVDNYFAHAS STTRDNNTFP FDDFSGEAEA ISSSVAAAAG PQDRMLPIAN VGRMMKQILP  60
PNAKISKEAK ETMQECVSEF ISFVTGEASD KCHKEKRKTV NGDDVCWALS SLGFDDYCSP  120
LKRYLLRYRE LEGERAARSD YNTAPSGSGK RTARQQEEEE EEEVLHHHHS KICN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-4142130492Transcription factor HapC (Eurofung)
4g92_B2e-4142130492Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008368975.14e-63PREDICTED: nuclear transcription factor Y subunit B-5
RefseqXP_010259679.17e-63PREDICTED: nuclear transcription factor Y subunit B-5-like
SwissprotO822488e-57NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLA0A0S3SS712e-62A0A0S3SS71_PHAAN; Uncharacterized protein
TrEMBLA0A0L9TWP12e-62A0A0L9TWP1_PHAAN; Uncharacterized protein
TrEMBLM0TP552e-62M0TP55_MUSAM; Uncharacterized protein
TrEMBLA0A0J8C1942e-62A0A0J8C194_BETVU; Uncharacterized protein
STRINGGSMUA_Achr8P10020_0016e-62(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.16e-50nuclear factor Y, subunit B5